Lineage for d2k9xa_ (2k9x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933706Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2933765Family d.15.3.0: automated matches [191373] (1 protein)
    not a true family
  6. 2933766Protein automated matches [190452] (4 species)
    not a true protein
  7. 2933778Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255330] (1 PDB entry)
  8. 2933779Domain d2k9xa_: 2k9x A: [242431]
    automated match to d2qjla_

Details for d2k9xa_

PDB Entry: 2k9x (more details)

PDB Description: solution structure of urm1 from trypanosoma brucei
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2k9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k9xa_ d.15.3.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
msnhnhitvqfaggcellfakqtslqldgvvptgtnlnglvqllktnyvkerpdllvdqt
gqtlrpgilvlvnscdaevvggmdyvlndgdtvefistlhgg

SCOPe Domain Coordinates for d2k9xa_:

Click to download the PDB-style file with coordinates for d2k9xa_.
(The format of our PDB-style files is described here.)

Timeline for d2k9xa_: