Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries) |
Domain d2k8md1: 2k8m D:3-128 [242418] Other proteins in same PDB: d2k8ma2, d2k8mb_, d2k8mc_, d2k8md2 automated match to d1byna_ |
PDB Entry: 2k8m (more details)
SCOPe Domain Sequences for d2k8md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k8md1 b.7.1.2 (D:3-128) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]} lgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrkt lnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewrd lqsaek
Timeline for d2k8md1:
View in 3D Domains from other chains: (mouse over for more information) d2k8ma1, d2k8ma2, d2k8mb_, d2k8mc_ |