SCOPe 2.08: Domain d2k7sa1: 2k7s A:5-119

Lineage for d2k7sa1 (2k7s A:5-119)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)

8. Domain d2k7sa1: 2k7s A:5-119 [242405]
   Other proteins in same PDB: d2k7sa2
   automated match to d3h82b_

Details for d2k7sa1

PDB Entry: 2k7s

PDB Description: human arnt c-terminal pas domain, 3 residue ib slip

PDB Compounds: (A:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d2k7sa1:

Sequence; same for both SEQRES and ATOM records:

>d2k7sa1 d.110.3.0 (A:5-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvcqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqv
vklkgqvlsvmfrfrsknqewlwmrtssqtaqnpysdeietiictntnvknssqe

Timeline for d2k7sa1:

• d2k7sa1 first appeared in SCOPe 2.04, called d2k7sa_
  
• d2k7sa1 appears in SCOPe 2.07