SCOPe 2.06: Domain d2k5ua_: 2k5u A:

Lineage for d2k5ua_ (2k5u A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)

8. Domain d2k5ua_: 2k5u A: [242383]
   automated match to d3lrpa_
   complexed with gdp

Details for d2k5ua_

PDB Entry: 2k5u

PDB Description: solution structure of myirstoylated yeast arf1 protein, gdp-bound

PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d2k5ua_:

Sequence; same for both SEQRES and ATOM records:

>d2k5ua_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
xglfasklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvetvqykn
isftvwdvggqdrirslwrhyyrntegvifvvdsndrsrigearevmqrmlnedelrnaa
wlvfankqdlpeamsaaeiteklglhsirnrpwfiqatcatsgeglyeglewlsnslkns
t

Timeline for d2k5ua_:

• d2k5ua_ first appeared in SCOPe 2.04
  
• d2k5ua_ appears in SCOPe 2.05
  
• d2k5ua_ appears in SCOPe 2.07
  
• d2k5ua_ appears in the current release, SCOPe 2.08