Lineage for d2k40a_ (2k40 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982516Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)
  8. 1982527Domain d2k40a_: 2k40 A: [242368]
    automated match to d2cuea1
    mutant

Details for d2k40a_

PDB Entry: 2k40 (more details)

PDB Description: nmr structure of hesx-1 homeodomain double mutant r31l/e42l
PDB Compounds: (A:) Homeobox expressed in ES cells 1

SCOPe Domain Sequences for d2k40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k40a_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grrprtaftqnqievlenvfrvncypgidiledlaqklnleldriqiwfqnrraklkrsh
resqflm

SCOPe Domain Coordinates for d2k40a_:

Click to download the PDB-style file with coordinates for d2k40a_.
(The format of our PDB-style files is described here.)

Timeline for d2k40a_: