SCOPe 2.08: Domain d2k2xa1: 2k2x A:1-37

Lineage for d2k2xa1 (2k2x A:1-37)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)

6. Protein automated matches [254564] (1 species)
   not a true protein

7. Species Rhipicephalus bursa [255296] (2 PDB entries)

8. Domain d2k2xa1: 2k2x A:1-37 [242361]
   automated match to d3d4ub1

Details for d2k2xa1

PDB Entry: 2k2x

PDB Description: solution structure of tick carboxypeptidase inhibitor at ph 3.5

PDB Compounds: (A:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d2k2xa1:

Sequence; same for both SEQRES and ATOM records:

>d2k2xa1 g.9.1.3 (A:1-37) automated matches {Rhipicephalus bursa}
necvskgfgclpqsdcpqearlsyggcstvccdlskl

Timeline for d2k2xa1:

• d2k2xa1 first appeared in SCOPe 2.04
  
• d2k2xa1 appears in SCOPe 2.07