SCOPe 2.08: Domain d2k1wa1: 2k1w A:2-85

Lineage for d2k1wa1 (2k1w A:2-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Methanosarcina acetivorans [TaxId:2214] [232522] (3 PDB entries)

8. Domain d2k1wa1: 2k1w A:2-85 [242350]
   Other proteins in same PDB: d2k1wa2
   automated match to d3hz2a_
   complexed with ca

Details for d2k1wa1

PDB Entry: 2k1w

PDB Description: nmr solution structure of m-crystallin in calcium loaded form(holo).

PDB Compounds: (A:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d2k1wa1:

Sequence; same for both SEQRES and ATOM records:

>d2k1wa1 b.11.1.0 (A:2-85) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

Timeline for d2k1wa1:

• d2k1wa1 first appeared in SCOPe 2.04, called d2k1wa_
  
• d2k1wa1 appears in SCOPe 2.07