Lineage for d2k0ca_ (2k0c A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037322Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 3037334Protein Nuclear pore complex protein nup153 [161175] (2 species)
  7. 3037338Species Norway rat (Rattus norvegicus) [TaxId:10116] [188480] (8 PDB entries)
  8. 3037347Domain d2k0ca_: 2k0c A: [242337]
    automated match to d3ch5b_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d2k0ca_

PDB Entry: 2k0c (more details)

PDB Description: zinc-finger 2 of nup153
PDB Compounds: (A:) Nuclear pore complex protein Nup153

SCOPe Domain Sequences for d2k0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k0ca_ g.41.11.1 (A:) Nuclear pore complex protein nup153 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aigtwdcdtclvqnkpeavkcvacetpkpgtgvkr

SCOPe Domain Coordinates for d2k0ca_:

Click to download the PDB-style file with coordinates for d2k0ca_.
(The format of our PDB-style files is described here.)

Timeline for d2k0ca_: