Lineage for d2jw4a1 (2jw4 A:4-66)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783611Domain d2jw4a1: 2jw4 A:4-66 [242297]
    Other proteins in same PDB: d2jw4a2, d2jw4a3
    automated match to d5hcka_

Details for d2jw4a1

PDB Entry: 2jw4 (more details)

PDB Description: nmr solution structure of the n-terminal sh3 domain of human nckalpha
PDB Compounds: (A:) cytoplasmic protein nck1

SCOPe Domain Sequences for d2jw4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jw4a1 b.34.2.0 (A:4-66) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkn
sar

SCOPe Domain Coordinates for d2jw4a1:

Click to download the PDB-style file with coordinates for d2jw4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jw4a1: