Lineage for d2jv9a_ (2jv9 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1734996Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1734997Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1735075Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1735076Protein automated matches [226856] (2 species)
    not a true protein
  7. 1735134Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries)
  8. 1735136Domain d2jv9a_: 2jv9 A: [242290]
    automated match to d1bhdb_

Details for d2jv9a_

PDB Entry: 2jv9 (more details)

PDB Description: The Solution Structure of Calponin Homology Domain from Smoothelin-like 1
PDB Compounds: (A:) Smoothelin-like 1

SCOPe Domain Sequences for d2jv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jv9a_ a.40.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgsknmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakr
rhnftlafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk

SCOPe Domain Coordinates for d2jv9a_:

Click to download the PDB-style file with coordinates for d2jv9a_.
(The format of our PDB-style files is described here.)

Timeline for d2jv9a_: