Lineage for d2jrca_ (2jrc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889344Species Mycobacterium tuberculosis [TaxId:83332] [225299] (7 PDB entries)
  8. 2889353Domain d2jrca_: 2jrc A: [242270]
    automated match to d1ryna_

Details for d2jrca_

PDB Entry: 2jrc (more details)

PDB Description: solution structure of peptidyl-trna hydrolase from mycobacterium tuberculosis h37rv.
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2jrca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jrca_ c.56.3.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
maepllvvglgnpganyartrhnlgfvvadllaarlgakfkahkrsgaevatgrsagrsl
vlakprcymnesgrqigplakfysvapaniivihddldlefgrirlkigggegghnglrs
vvaalgtkdfqrvrigigrppgrkdpaafvlenftpaeraevpticeqaadatellieqg
mepaqnrvhaw

SCOPe Domain Coordinates for d2jrca_:

Click to download the PDB-style file with coordinates for d2jrca_.
(The format of our PDB-style files is described here.)

Timeline for d2jrca_: