Lineage for d2jqma_ (2jqm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766586Species Yellow fever virus [255286] (1 PDB entry)
  8. 2766587Domain d2jqma_: 2jqm A: [242264]
    automated match to d1s6na_

Details for d2jqma_

PDB Entry: 2jqm (more details)

PDB Description: yellow fever envelope protein domain iii nmr structure (s288-k398)
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d2jqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jqma_ b.1.18.0 (A:) automated matches {Yellow fever virus}
msaltlkgtsykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaaink
gilvtvnpiastnddevlievnppfgdsyiivgtgdsrltyqwhkegssigk

SCOPe Domain Coordinates for d2jqma_:

Click to download the PDB-style file with coordinates for d2jqma_.
(The format of our PDB-style files is described here.)

Timeline for d2jqma_: