Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Yellow fever virus [255286] (1 PDB entry) |
Domain d2jqma_: 2jqm A: [242264] automated match to d1s6na_ |
PDB Entry: 2jqm (more details)
SCOPe Domain Sequences for d2jqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jqma_ b.1.18.0 (A:) automated matches {Yellow fever virus} msaltlkgtsykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaaink gilvtvnpiastnddevlievnppfgdsyiivgtgdsrltyqwhkegssigk
Timeline for d2jqma_: