SCOPe 2.04: Domain d2jf6b_: 2jf6 B:

Lineage for d2jf6b_ (2jf6 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (60 species)
   not a true protein

7. Species Rauvolfia serpentina [TaxId:4060] [189830] (12 PDB entries)

8. Domain d2jf6b_: 2jf6 B: [242219]
   automated match to d1hxjb_
   complexed with s55; mutant

Details for d2jf6b_

PDB Entry: 2jf6, 2.82 Å

PDB Description: structure of inactive mutant of strictosidine glucosidase in complex with strictosidine

PDB Compounds: (B:) strictosidine-o-beta-d-glucosidase

SCOPe Domain Sequences for d2jf6b_:

Sequence; same for both SEQRES and ATOM records:

>d2jf6b_ c.1.8.0 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
ydfigmnyytatyvtnavksnseklsyetddqvtktfernqkpighalyggwqhvvpwgl
ykllvytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddg
vnvkgyfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag

Timeline for d2jf6b_:

• d2jf6b_ is new in SCOPe 2.04-stable
  
• d2jf6b_ appears in SCOPe 2.05
  
• d2jf6b_ appears in the current release, SCOPe 2.08