SCOPe 2.04: Domain d2jaga_: 2jag A:

Lineage for d2jaga_ (2jag A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (3 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein automated matches [190122] (5 species)
   not a true protein

7. Species Halobacterium salinarium [TaxId:2242] [188662] (3 PDB entries)

8. Domain d2jaga_: 2jag A: [242208]
   automated match to d1e12a_
   complexed with bog, cl, plm, ret

Details for d2jaga_

PDB Entry: 2jag, 1.93 Å

PDB Description: l1-intermediate of halorhodopsin t203v

PDB Compounds: (A:) halorhodopsin

SCOPe Domain Sequences for d2jaga_:

Sequence; same for both SEQRES and ATOM records:

>d2jaga_ f.13.1.1 (A:) automated matches {Halobacterium salinarium [TaxId: 2242]}
avrenallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgll
sgltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaad
igmcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrv
lvvvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertva
va

Timeline for d2jaga_:

• d2jaga_ is new in SCOPe 2.04-stable
  
• d2jaga_ appears in SCOPe 2.05
  
• d2jaga_ appears in the current release, SCOPe 2.08