Lineage for d2jaga_ (2jag A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576672Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2576831Protein automated matches [190122] (7 species)
    not a true protein
  7. 2576832Species Halobacterium salinarium [TaxId:2242] [188662] (3 PDB entries)
  8. 2576834Domain d2jaga_: 2jag A: [242208]
    automated match to d1e12a_
    complexed with bog, cl, plm, ret

Details for d2jaga_

PDB Entry: 2jag (more details), 1.93 Å

PDB Description: l1-intermediate of halorhodopsin t203v
PDB Compounds: (A:) halorhodopsin

SCOPe Domain Sequences for d2jaga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jaga_ f.13.1.1 (A:) automated matches {Halobacterium salinarium [TaxId: 2242]}
avrenallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgll
sgltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaad
igmcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrv
lvvvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertva
va

SCOPe Domain Coordinates for d2jaga_:

Click to download the PDB-style file with coordinates for d2jaga_.
(The format of our PDB-style files is described here.)

Timeline for d2jaga_: