Class b: All beta proteins [48724] (126 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins) |
Protein S-lectin, different isoforms [49933] (4 species) |
Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries) |
Domain d1ganb_: 1gan B: [24215] complexed with gal, nag |
PDB Entry: 1gan (more details), 2.23 Å
SCOP Domain Sequences for d1ganb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ganb_ b.29.1.3 (B:) S-lectin, different isoforms {Toad (Bufo arenarum)} asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf lsleglqfksitte
Timeline for d1ganb_: