Lineage for d1a78b_ (1a78 B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294847Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 294867Protein S-lectin, different isoforms [49933] (4 species)
  7. 294897Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)
  8. 294899Domain d1a78b_: 1a78 B: [24213]
    complexed with dtt, tdg

Details for d1a78b_

PDB Entry: 1a78 (more details), 2 Å

PDB Description: complex of toad ovary galectin with thio-digalactose

SCOP Domain Sequences for d1a78b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a78b_ b.29.1.3 (B:) S-lectin, different isoforms {Toad (Bufo arenarum)}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf
lsleglafksitte

SCOP Domain Coordinates for d1a78b_:

Click to download the PDB-style file with coordinates for d1a78b_.
(The format of our PDB-style files is described here.)

Timeline for d1a78b_: