SCOPe 2.04: Domain d2ihmb2: 2ihm B:231-289

Lineage for d2ihmb2 (2ihm B:231-289)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.0: automated matches [254215] (1 protein)
   not a true family
6. Protein automated matches [254483] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255237] (18 PDB entries)

8. Domain d2ihmb2: 2ihm B:231-289 [242127]
   Other proteins in same PDB: d2ihma1, d2ihma3, d2ihmb1, d2ihmb3
   automated match to d1jmsa3
   protein/DNA complex; complexed with d3t, mg, na

Details for d2ihmb2

PDB Entry: 2ihm, 2.4 Å

PDB Description: polymerase mu in ternary complex with gapped 11mer dna duplex and bound incoming nucleotide

PDB Compounds: (B:) DNA polymerase mu

SCOPe Domain Sequences for d2ihmb2:

Sequence; same for both SEQRES and ATOM records:

>d2ihmb2 a.60.12.0 (B:231-289) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seryqtmklftqvfgvgvktanrwyqeglrtldelreqpqrltqqqkaglqyyqdlstp

Timeline for d2ihmb2:

• d2ihmb2 is new in SCOPe 2.04-stable
  
• d2ihmb2 appears in SCOPe 2.05
  
• d2ihmb2 appears in the current release, SCOPe 2.08