SCOPe 2.05: Domain d2ihmb1: 2ihm B:137-230

Lineage for d2ihmb1 (2ihm B:137-230)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255236] (29 PDB entries)

8. Domain d2ihmb1: 2ihm B:137-230 [242126]
   Other proteins in same PDB: d2ihma2, d2ihma3, d2ihmb2, d2ihmb3
   automated match to d1jmsa1
   protein/DNA complex; complexed with d3t, mg, na

Details for d2ihmb1

PDB Entry: 2ihm, 2.4 Å

PDB Description: polymerase mu in ternary complex with gapped 11mer dna duplex and bound incoming nucleotide

PDB Compounds: (B:) DNA polymerase mu

SCOPe Domain Sequences for d2ihmb1:

Sequence; same for both SEQRES and ATOM records:

>d2ihmb1 a.60.6.0 (B:137-230) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
smpayacqrpsplthhntllsealetlaeaagfeanegrllsfsraasvlkslpcpvasl
sqlhglpyfgehstrviqellehgtceevkqvrc

Timeline for d2ihmb1:

• d2ihmb1 first appeared in SCOPe 2.04
  
• d2ihmb1 appears in SCOPe 2.06
  
• d2ihmb1 appears in the current release, SCOPe 2.08