Lineage for d2ihmb1 (2ihm B:137-230)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493774Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1493989Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 1493990Protein automated matches [254482] (2 species)
    not a true protein
  7. 1493996Species Mouse (Mus musculus) [TaxId:10090] [255236] (18 PDB entries)
  8. 1494008Domain d2ihmb1: 2ihm B:137-230 [242126]
    Other proteins in same PDB: d2ihma2, d2ihma3, d2ihmb2, d2ihmb3
    automated match to d1jmsa1
    protein/DNA complex; complexed with d3t, mg, na

Details for d2ihmb1

PDB Entry: 2ihm (more details), 2.4 Å

PDB Description: polymerase mu in ternary complex with gapped 11mer dna duplex and bound incoming nucleotide
PDB Compounds: (B:) DNA polymerase mu

SCOPe Domain Sequences for d2ihmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihmb1 a.60.6.0 (B:137-230) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
smpayacqrpsplthhntllsealetlaeaagfeanegrllsfsraasvlkslpcpvasl
sqlhglpyfgehstrviqellehgtceevkqvrc

SCOPe Domain Coordinates for d2ihmb1:

Click to download the PDB-style file with coordinates for d2ihmb1.
(The format of our PDB-style files is described here.)

Timeline for d2ihmb1: