SCOPe 2.05: Domain d2ihma3: 2ihm A:290-496

Lineage for d2ihma3 (2ihm A:290-496)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.0: automated matches [227287] (1 protein)
   not a true family

6. Protein automated matches [227105] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255238] (1 PDB entry)

8. Domain d2ihma3: 2ihm A:290-496 [242125]
   Other proteins in same PDB: d2ihma1, d2ihma2, d2ihmb1, d2ihmb2
   automated match to d1jmsa4
   protein/DNA complex; complexed with d3t, mg, na

Details for d2ihma3

PDB Entry: 2ihm, 2.4 Å

PDB Description: polymerase mu in ternary complex with gapped 11mer dna duplex and bound incoming nucleotide

PDB Compounds: (A:) DNA polymerase mu

SCOPe Domain Sequences for d2ihma3:

Sequence, based on SEQRES records:

>d2ihma3 d.218.1.0 (A:290-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrradaealqqlieaavrqtlpgatvtltggfrrgklqghdvdflithpeegqevgllpk
vmsclqsqglvlyhqyhrshladsahnlrqrsstmdvfersfcilglpqpqqaalagalp
pcptwkavrvdlvvtpssqfpfallgwtgsqfferelrrfsrqekglwlnshglfdpeqk
rvfhatseedvfrllglkylppeqrna

Sequence, based on observed residues (ATOM records):

>d2ihma3 d.218.1.0 (A:290-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrradaealqqlieaavrqtlpgatvtltggfrrgklqghdvdflithpeegqevgllpk
vmsclqsqglvlyhqyhrshdvfersfcilglpqptwkavrvdlvvtpssqfpfallgwt
gsqfferelrrfsrqekglwlnshglfdpeqkrvfhatseedvfrllglkylppeqrna

Timeline for d2ihma3:

• d2ihma3 first appeared in SCOPe 2.04
  
• d2ihma3 appears in SCOPe 2.06
  
• d2ihma3 appears in the current release, SCOPe 2.08