Lineage for d2ihma3 (2ihm A:290-496)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944794Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1944795Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1945267Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 1945268Protein automated matches [227105] (4 species)
    not a true protein
  7. 1945277Species Mouse (Mus musculus) [TaxId:10090] [255238] (1 PDB entry)
  8. 1945278Domain d2ihma3: 2ihm A:290-496 [242125]
    Other proteins in same PDB: d2ihma1, d2ihma2, d2ihmb1, d2ihmb2
    automated match to d1jmsa4
    protein/DNA complex; complexed with d3t, mg, na

Details for d2ihma3

PDB Entry: 2ihm (more details), 2.4 Å

PDB Description: polymerase mu in ternary complex with gapped 11mer dna duplex and bound incoming nucleotide
PDB Compounds: (A:) DNA polymerase mu

SCOPe Domain Sequences for d2ihma3:

Sequence, based on SEQRES records: (download)

>d2ihma3 d.218.1.0 (A:290-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrradaealqqlieaavrqtlpgatvtltggfrrgklqghdvdflithpeegqevgllpk
vmsclqsqglvlyhqyhrshladsahnlrqrsstmdvfersfcilglpqpqqaalagalp
pcptwkavrvdlvvtpssqfpfallgwtgsqfferelrrfsrqekglwlnshglfdpeqk
rvfhatseedvfrllglkylppeqrna

Sequence, based on observed residues (ATOM records): (download)

>d2ihma3 d.218.1.0 (A:290-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrradaealqqlieaavrqtlpgatvtltggfrrgklqghdvdflithpeegqevgllpk
vmsclqsqglvlyhqyhrshdvfersfcilglpqptwkavrvdlvvtpssqfpfallgwt
gsqfferelrrfsrqekglwlnshglfdpeqkrvfhatseedvfrllglkylppeqrna

SCOPe Domain Coordinates for d2ihma3:

Click to download the PDB-style file with coordinates for d2ihma3.
(The format of our PDB-style files is described here.)

Timeline for d2ihma3: