Lineage for d2ihma2 (2ihm A:231-289)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. Protein automated matches [254483] (3 species)
    not a true protein
  7. 1494462Species Mouse (Mus musculus) [TaxId:10090] [255237] (18 PDB entries)
  8. 1494473Domain d2ihma2: 2ihm A:231-289 [242124]
    Other proteins in same PDB: d2ihma1, d2ihma3, d2ihmb1, d2ihmb3
    automated match to d1jmsa3
    protein/DNA complex; complexed with d3t, mg, na

Details for d2ihma2

PDB Entry: 2ihm (more details), 2.4 Å

PDB Description: polymerase mu in ternary complex with gapped 11mer dna duplex and bound incoming nucleotide
PDB Compounds: (A:) DNA polymerase mu

SCOPe Domain Sequences for d2ihma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihma2 a.60.12.0 (A:231-289) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seryqtmklftqvfgvgvktanrwyqeglrtldelreqpqrltqqqkaglqyyqdlstp

SCOPe Domain Coordinates for d2ihma2:

Click to download the PDB-style file with coordinates for d2ihma2.
(The format of our PDB-style files is described here.)

Timeline for d2ihma2: