SCOPe 2.05: Domain d2if2a_: 2if2 A:

Lineage for d2if2a_ (2if2 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188217] (4 PDB entries)

8. Domain d2if2a_: 2if2 A: [242120]
   automated match to d4i1va_
   complexed with edo, so4

Details for d2if2a_

PDB Entry: 2if2, 3 Å

PDB Description: Crystal Structure of the Putative Dephospho-CoA Kinase from Aquifex aeolicus, Northeast Structural Genomics Target QR72.

PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d2if2a_:

Sequence; same for both SEQRES and ATOM records:

>d2if2a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mkrigltgnigcgkstvaqmfrelgayvldadklihsfyrkghpvyeevvktfgkgilde
egnidrkkladivfkdeeklrkleeithralykeiekitknlsedtlfileasllvekgt
yknydklivvyapyevckeraikrgmseedferrwkkqmpieekvkyadyvidnsgsiee
tykqvkkvyeeltr

Timeline for d2if2a_:

• d2if2a_ first appeared in SCOPe 2.04
  
• d2if2a_ appears in SCOPe 2.06
  
• d2if2a_ appears in the current release, SCOPe 2.08