Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186847] (9 PDB entries) |
Domain d2iezi_: 2iez I: [242119] automated match to d2f9ma_ complexed with ca, gdp |
PDB Entry: 2iez (more details), 2.8 Å
SCOPe Domain Sequences for d2iezi_:
Sequence, based on SEQRES records: (download)
>d2iezi_ c.37.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgas gkafkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanay cenpdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlim krmekcve
>d2iezi_ c.37.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfasgkafkhlqlwdtag lerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignkadl pdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcve
Timeline for d2iezi_: