Lineage for d2iezb_ (2iez B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850132Species Mouse (Mus musculus) [TaxId:10090] [186847] (9 PDB entries)
  8. 1850144Domain d2iezb_: 2iez B: [242117]
    automated match to d2f9ma_
    complexed with ca, gdp

Details for d2iezb_

PDB Entry: 2iez (more details), 2.8 Å

PDB Description: Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
PDB Compounds: (B:) Ras-related protein Rab-27B

SCOPe Domain Sequences for d2iezb_:

Sequence, based on SEQRES records: (download)

>d2iezb_ c.37.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgas
gkafkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanay
cenpdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlim
krmekcv

Sequence, based on observed residues (ATOM records): (download)

>d2iezb_ c.37.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvhlqlwdtagl
erfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignkadlp
dqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcv

SCOPe Domain Coordinates for d2iezb_:

Click to download the PDB-style file with coordinates for d2iezb_.
(The format of our PDB-style files is described here.)

Timeline for d2iezb_: