Lineage for d2ibla_ (2ibl A:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591146Superfamily h.1.17: Fibritin [58046] (1 family) (S)
  5. 2591147Family h.1.17.1: Fibritin [58047] (1 protein)
  6. 2591148Protein Fibritin [58048] (2 species)
    biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet
  7. 2591168Species Unidentified phage [TaxId:38018] [255235] (1 PDB entry)
  8. 2591169Domain d2ibla_: 2ibl A: [242107]
    automated match to d1ox3a_

Details for d2ibla_

PDB Entry: 2ibl (more details), 1.32 Å

PDB Description: crystal structure of a helper molecule (ht-mf-thromb) based on mini- fibritin (mf) crystal structure (pdb:1ox3).
PDB Compounds: (A:) fibritin

SCOPe Domain Sequences for d2ibla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibla_ h.1.17.1 (A:) Fibritin {Unidentified phage [TaxId: 38018]}
divlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldkn
igilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl

SCOPe Domain Coordinates for d2ibla_:

Click to download the PDB-style file with coordinates for d2ibla_.
(The format of our PDB-style files is described here.)

Timeline for d2ibla_: