Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d2i9le2: 2i9l E:113-219 [242103] Other proteins in same PDB: d2i9la1, d2i9lb1, d2i9lb2, d2i9lc1, d2i9ld1, d2i9ld2, d2i9le1, d2i9lf1, d2i9lf2, d2i9lg1, d2i9lh1, d2i9lh2 automated match to d3okka2 complexed with gol |
PDB Entry: 2i9l (more details), 3.1 Å
SCOPe Domain Sequences for d2i9le2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9le2 b.1.1.2 (E:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgseraagvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2i9le2: