SCOPe 2.08: Domain d2i9lc2: 2i9l C:113-219

Lineage for d2i9lc2 (2i9l C:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2i9lc2: 2i9l C:113-219 [242101]
   Other proteins in same PDB: d2i9la1, d2i9lb1, d2i9lb2, d2i9lc1, d2i9ld1, d2i9ld2, d2i9le1, d2i9lf1, d2i9lf2, d2i9lg1, d2i9lh1, d2i9lh2
   automated match to d3okka2
   complexed with gol

Details for d2i9lc2

PDB Entry: 2i9l, 3.1 Å

PDB Description: structure of fab 7d11 from a neutralizing antibody against the poxvirus l1 protein

PDB Compounds: (C:) Antibody 7D11 light chain

SCOPe Domain Sequences for d2i9lc2:

Sequence; same for both SEQRES and ATOM records:

>d2i9lc2 b.1.1.2 (C:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgseraagvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2i9lc2:

• d2i9lc2 first appeared in SCOPe 2.04
  
• d2i9lc2 appears in SCOPe 2.07