SCOP 1.65: Domain d5galb_: 5gal B:

Lineage for d5galb_ (5gal B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)

6. Protein S-lectin, different isoforms [49933] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)

8. Domain d5galb_: 5gal B: [24207]
   complexed with gal, nag

Details for d5galb_

PDB Entry: 5gal, 2 Å

PDB Description: crystal structure of human galectin-7 in complex with n- acetyllactosamine

SCOP Domain Sequences for d5galb_:

Sequence; same for both SEQRES and ATOM records:

>d5galb_ b.29.1.3 (B:) S-lectin, different isoforms {Human (Homo sapiens)}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

Timeline for d5galb_:

• d5galb_ first appeared (with stable ids) in SCOP 1.55
  
• d5galb_ appears in SCOP 1.63
  
• d5galb_ appears in SCOP 1.67
  
• d5galb_ appears in the current release, SCOPe 2.08