Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (17 species) not a true protein |
Species Helicobacter pylori [TaxId:85963] [255221] (3 PDB entries) |
Domain d2hqra2: 2hqr A:118-223 [242057] Other proteins in same PDB: d2hqra1, d2hqrb1 automated match to d1kgsa1 |
PDB Entry: 2hqr (more details)
SCOPe Domain Sequences for d2hqra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqra2 a.4.6.0 (A:118-223) automated matches {Helicobacter pylori [TaxId: 85963]} snvieigdltispdeekiiykgrevevkgkpfevlthlarhrdqivskeqlldaiweepe mvtpnvievainqirqkmdkplgistvetvrrrgyrfcypkpacee
Timeline for d2hqra2: