SCOPe 2.06: Domain d2hqob_: 2hqo B:

Lineage for d2hqob_ (2hqo B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [255222] (2 PDB entries)

8. Domain d2hqob_: 2hqo B: [242055]
   automated match to d2plna_

Details for d2hqob_

PDB Entry: 2hqo

PDB Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism

PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hqob_:

Sequence; same for both SEQRES and ATOM records:

>d2hqob_ c.23.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85963]}
mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwgsn

Timeline for d2hqob_:

• d2hqob_ first appeared in SCOPe 2.04
  
• d2hqob_ appears in SCOPe 2.05
  
• d2hqob_ appears in SCOPe 2.07
  
• d2hqob_ appears in the current release, SCOPe 2.08