![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries) |
![]() | Domain d2he7a3: 2he7 A:297-390 [242030] Other proteins in same PDB: d2he7a1, d2he7a2 automated match to d1gg3a2 |
PDB Entry: 2he7 (more details), 2 Å
SCOPe Domain Sequences for d2he7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2he7a3 b.55.1.0 (A:297-390) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyikirpgef eqfestigfklpnhraakrlwkvcvehhtffrll
Timeline for d2he7a3: