Lineage for d2he7a3 (2he7 A:297-390)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551373Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1551374Protein automated matches [190052] (5 species)
    not a true protein
  7. 1551393Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries)
  8. 1551397Domain d2he7a3: 2he7 A:297-390 [242030]
    Other proteins in same PDB: d2he7a1, d2he7a2
    automated match to d1gg3a2

Details for d2he7a3

PDB Entry: 2he7 (more details), 2 Å

PDB Description: FERM domain of EPB41L3 (DAL-1)
PDB Compounds: (A:) Band 4.1-like protein 3

SCOPe Domain Sequences for d2he7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2he7a3 b.55.1.0 (A:297-390) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyikirpgef
eqfestigfklpnhraakrlwkvcvehhtffrll

SCOPe Domain Coordinates for d2he7a3:

Click to download the PDB-style file with coordinates for d2he7a3.
(The format of our PDB-style files is described here.)

Timeline for d2he7a3: