Lineage for d2he0b_ (2he0 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685843Species Human (Homo sapiens) [TaxId:9606] [187689] (7 PDB entries)
  8. 1685849Domain d2he0b_: 2he0 B: [242027]
    automated match to d2f8yb_
    complexed with edo; mutant

Details for d2he0b_

PDB Entry: 2he0 (more details), 1.9 Å

PDB Description: crystal structure of a human notch1 ankyrin domain mutant
PDB Compounds: (B:) Notch1 preproprotein variant

SCOPe Domain Sequences for d2he0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2he0b_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtdrtgatalhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
ermhhdivrlldl

SCOPe Domain Coordinates for d2he0b_:

Click to download the PDB-style file with coordinates for d2he0b_.
(The format of our PDB-style files is described here.)

Timeline for d2he0b_: