SCOPe 2.06: Domain d2h2ra_: 2h2r A:

Lineage for d2h2ra_ (2h2r A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)

8. Domain d2h2ra_: 2h2r A: [241995]
   automated match to d1t8ca1

Details for d2h2ra_

PDB Entry: 2h2r, 1.5 Å

PDB Description: crystal structure of the human cd23 lectin domain, apo form

PDB Compounds: (A:) Low affinity immunoglobulin epsilon Fc receptor (Lymphocyte IgE receptor) (Fc-epsilon-RII)(Immunoglobulin E-binding factor) (CD23 antigen)

SCOPe Domain Sequences for d2h2ra_:

Sequence; same for both SEQRES and ATOM records:

>d2h2ra_ d.169.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkrasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqsedcvmmrgsgrwndafcdrkl
gawvcdrlatctppa

Timeline for d2h2ra_:

• d2h2ra_ first appeared in SCOPe 2.04
  
• d2h2ra_ appears in SCOPe 2.05
  
• d2h2ra_ appears in SCOPe 2.07
  
• d2h2ra_ appears in the current release, SCOPe 2.08