Lineage for d2gsba_ (2gsb A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919174Species Human (Homo sapiens) [TaxId:9606] [187549] (41 PDB entries)
  8. 1919231Domain d2gsba_: 2gsb A: [241974]
    automated match to d3n84b_

Details for d2gsba_

PDB Entry: 2gsb (more details)

PDB Description: Solution structure of the second SH2 domain of human Ras GTPase-activating protein 1
PDB Compounds: (A:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d2gsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsba_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgreedphegkiwfhgkiskqeaynllmtvgqvcsflvrpsdntpgdyslyfrtn
eniqrfkicptpnnqfmmggryynsigdiidhyrkeqivegyylkepvpmqdqsgpssg

SCOPe Domain Coordinates for d2gsba_:

Click to download the PDB-style file with coordinates for d2gsba_.
(The format of our PDB-style files is described here.)

Timeline for d2gsba_: