Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (30 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries) |
Domain d2gr9e2: 2gr9 E:165-275 [241962] Other proteins in same PDB: d2gr9a1, d2gr9b1, d2gr9c1, d2gr9d1, d2gr9e1 automated match to d2izzb2 complexed with glu, nai |
PDB Entry: 2gr9 (more details), 3.1 Å
SCOPe Domain Sequences for d2gr9e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gr9e2 a.100.1.0 (E:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe
Timeline for d2gr9e2: