SCOP 1.69: Domain d1slaa_: 1sla A:

Lineage for d1slaa_ (1sla A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-1 [100925] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)

8. Domain d1slaa_: 1sla A: [24196]

Details for d1slaa_

PDB Entry: 1sla, 2.45 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slaa_:

Sequence; same for both SEQRES and ATOM records:

>d1slaa_ b.29.1.3 (A:) Galectin-1 {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

Timeline for d1slaa_:

• d1slaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1slaa_ appears in SCOP 1.67
  
• d1slaa_ appears in SCOP 1.71
  
• d1slaa_ appears in the current release, SCOPe 2.08