Class b: All beta proteins [48724] (141 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
Protein Galectin-1 [100925] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries) |
Domain d1slbd_: 1slb D: [24195] complexed with gal, man, nag |
PDB Entry: 1slb (more details), 2.3 Å
SCOP Domain Sequences for d1slbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1slbd_ b.29.1.3 (D:) Galectin-1 {Cow (Bos taurus)} acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl saggdfkikcvafe
Timeline for d1slbd_: