Lineage for d1slbd_ (1slb D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371566Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 371583Protein Galectin-1 [100925] (4 species)
  7. 371587Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 371597Domain d1slbd_: 1slb D: [24195]
    complexed with gal, man, nag

Details for d1slbd_

PDB Entry: 1slb (more details), 2.3 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slbd_ b.29.1.3 (D:) Galectin-1 {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOP Domain Coordinates for d1slbd_:

Click to download the PDB-style file with coordinates for d1slbd_.
(The format of our PDB-style files is described here.)

Timeline for d1slbd_: