SCOPe 2.04: Domain d2gere2: 2ger E:165-275

Lineage for d2gere2 (2ger E:165-275)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)

8. Domain d2gere2: 2ger E:165-275 [241930]
   Other proteins in same PDB: d2gera1, d2gerb1, d2gerc1, d2gerd1, d2gere1
   automated match to d2izzb2

Details for d2gere2

PDB Entry: 2ger, 3.1 Å

PDB Description: Crystal Structure and Oxidative Mechanism of Human Pyrroline-5-carboxylate Reductase

PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2gere2:

Sequence; same for both SEQRES and ATOM records:

>d2gere2 a.100.1.0 (E:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe

Timeline for d2gere2:

• d2gere2 is new in SCOPe 2.04-stable
  
• d2gere2 appears in SCOPe 2.05
  
• d2gere2 appears in the current release, SCOPe 2.08