Lineage for d2g18g1 (2g18 G:2-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008710Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 3008751Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) (S)
    Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349
  5. 3008752Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 proteins)
  6. 3008771Protein automated matches [254531] (2 species)
    not a true protein
  7. 3008772Species Anabaena sp. [TaxId:1167] [255178] (1 PDB entry)
  8. 3008779Domain d2g18g1: 2g18 G:2-245 [241894]
    Other proteins in same PDB: d2g18a2, d2g18b2, d2g18c2, d2g18d2, d2g18e2, d2g18f2, d2g18g2, d2g18h2
    automated match to d2d1ea_
    complexed with ca

Details for d2g18g1

PDB Entry: 2g18 (more details), 2.5 Å

PDB Description: crystal structure of nostoc sp. 7120 phycocyanobilin:ferredoxin oxidoreductase (pcya) apoprotein
PDB Compounds: (G:) Phycocyanobilin:ferredoxin oxidoreductase

SCOPe Domain Sequences for d2g18g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g18g1 d.248.2.1 (G:2-245) automated matches {Anabaena sp. [TaxId: 1167]}
sltsipslreqqhplirqladcieevwhqhldlspyhlpaelgyvegrlegekltienrc
yqtpqfrkmhlelakvgnmldilhcvmfprpeydlpmfgcdlvggrgqisaaiadlspvh
ldrtlpesynsaltslntlnfsqprelpewgnifsdfcifvrpsspeeeamflgrvrefl
qvhcqgaiaaspvsaeqkqqilagqhnycskqqqndktrrvlekafgvdwaenymttvlf
dlpe

SCOPe Domain Coordinates for d2g18g1:

Click to download the PDB-style file with coordinates for d2g18g1.
(The format of our PDB-style files is described here.)

Timeline for d2g18g1: