Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies) alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567 |
Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349 |
Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 proteins) |
Protein automated matches [254531] (2 species) not a true protein |
Species Anabaena sp. [TaxId:1167] [255178] (1 PDB entry) |
Domain d2g18d1: 2g18 D:2-245 [241891] Other proteins in same PDB: d2g18a2, d2g18b2, d2g18c2, d2g18d2, d2g18e2, d2g18f2, d2g18g2, d2g18h2 automated match to d2d1ea_ complexed with ca |
PDB Entry: 2g18 (more details), 2.5 Å
SCOPe Domain Sequences for d2g18d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g18d1 d.248.2.1 (D:2-245) automated matches {Anabaena sp. [TaxId: 1167]} sltsipslreqqhplirqladcieevwhqhldlspyhlpaelgyvegrlegekltienrc yqtpqfrkmhlelakvgnmldilhcvmfprpeydlpmfgcdlvggrgqisaaiadlspvh ldrtlpesynsaltslntlnfsqprelpewgnifsdfcifvrpsspeeeamflgrvrefl qvhcqgaiaaspvsaeqkqqilagqhnycskqqqndktrrvlekafgvdwaenymttvlf dlpe
Timeline for d2g18d1: