Lineage for d2fonb2 (2fon B:273-461)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708695Species Solanum lycopersicum [TaxId:4081] [255174] (1 PDB entry)
  8. 2708698Domain d2fonb2: 2fon B:273-461 [241873]
    Other proteins in same PDB: d2fona1, d2fonb1, d2fonc1
    automated match to d1w07a1
    complexed with fad

Details for d2fonb2

PDB Entry: 2fon (more details), 2.74 Å

PDB Description: x-ray crystal structure of leacx1, an acyl-coa oxidase from lycopersicon esculentum (tomato)
PDB Compounds: (B:) peroxisomal acyl-CoA oxidase 1A

SCOPe Domain Sequences for d2fonb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fonb2 a.29.3.0 (B:273-461) automated matches {Solanum lycopersicum [TaxId: 4081]}
prqllygtmvyvrqsivadaslamsravciatrysavrrqfgsqnggqetqvidyktqqn
rlfpllasayafrfvgewlkwlytdvtqrlaandfstlpeahactaglkslttsatadgi
eecrklcgghgylcssglpelfavyvpactyegdnvvlqlqvarflmktisqlgtgkkpv
gtvsymgri

SCOPe Domain Coordinates for d2fonb2:

Click to download the PDB-style file with coordinates for d2fonb2.
(The format of our PDB-style files is described here.)

Timeline for d2fonb2: