SCOPe 2.05: Domain d2fl5l1: 2fl5 L:1-106

Lineage for d2fl5l1 (2fl5 L:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2fl5l1: 2fl5 L:1-106 [241865]
   automated match to d4m5yl1
   complexed with rbf

Details for d2fl5l1

PDB Entry: 2fl5, 3 Å

PDB Description: cofactor-containing antibodies: crystal structure of the original yellow antibody

PDB Compounds: (L:) Immunoglobulin Igg1 Lambda Light Chain

SCOPe Domain Sequences for d2fl5l1:

Sequence; same for both SEQRES and ATOM records:

>d2fl5l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syelkqppsvsvspgqtaritcsgdvlpkkyaywyqersgqapvlvvyedsgrpseiper
fsgsssgtkatltisgaqvedeadyycysdisngyplfgggtklsv

Timeline for d2fl5l1:

• d2fl5l1 first appeared in SCOPe 2.04
  
• d2fl5l1 appears in SCOPe 2.06
  
• d2fl5l1 appears in the current release, SCOPe 2.08