SCOPe 2.04: Domain d2fbwo2: 2fbw O:115-246

Lineage for d2fbwo2 (2fbw O:115-246)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly opened
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
contains two Fe4-S4 clusters
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
Protein Succinate dehydogenase [81669] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)

Domain d2fbwo2: 2fbw O:115-246 [241824]
Other proteins in same PDB: d2fbwb1, d2fbwc_, d2fbwd_, d2fbwo1, d2fbwp_, d2fbwq_
automated match to d1yq3b2
complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, pee, sf4, teo, unl

Details for d2fbwo2

PDB Entry: 2fbw (more details), 2.1 Å

PDB Description: avian respiratory complex ii with carboxin bound

PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2fbwo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbwo2 a.1.2.1 (O:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

SCOPe Domain Coordinates for d2fbwo2:

Click to download the PDB-style file with coordinates for d2fbwo2.
(The format of our PDB-style files is described here.)

Timeline for d2fbwo2: