Lineage for d2fbwo1 (2fbw O:8-114)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638928Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1639023Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 1639024Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries)
  8. 1639030Domain d2fbwo1: 2fbw O:8-114 [241823]
    Other proteins in same PDB: d2fbwb2, d2fbwc_, d2fbwd_, d2fbwo2, d2fbwp_, d2fbwq_
    automated match to d1yq3b1
    complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, pee, sf4, teo, unl

Details for d2fbwo1

PDB Entry: 2fbw (more details), 2.1 Å

PDB Description: avian respiratory complex ii with carboxin bound
PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2fbwo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbwo1 d.15.4.2 (O:8-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre
gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

SCOPe Domain Coordinates for d2fbwo1:

Click to download the PDB-style file with coordinates for d2fbwo1.
(The format of our PDB-style files is described here.)

Timeline for d2fbwo1: