Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries) |
Domain d2fbwo1: 2fbw O:8-114 [241823] Other proteins in same PDB: d2fbwb2, d2fbwc_, d2fbwd_, d2fbwo2, d2fbwp_, d2fbwq_ automated match to d1yq3b1 complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, pee, sf4, teo, unl |
PDB Entry: 2fbw (more details), 2.1 Å
SCOPe Domain Sequences for d2fbwo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbwo1 d.15.4.2 (O:8-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd
Timeline for d2fbwo1: