SCOPe 2.07: Domain d2f8vd2: 2f8v D:101-194

Lineage for d2f8vd2 (2f8v D:101-194)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2f8vd2: 2f8v D:101-194 [241818]
   Other proteins in same PDB: d2f8vb3
   automated match to d1g1ca_
   complexed with so4

Details for d2f8vd2

PDB Entry: 2f8v, 2.75 Å

PDB Description: structure of full length telethonin in complex with the n-terminus of titin

PDB Compounds: (D:) N2B-Titin Isoform

SCOPe Domain Sequences for d2f8vd2:

Sequence; same for both SEQRES and ATOM records:

>d2f8vd2 b.1.1.0 (D:101-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tappnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlys
lliaeaypedsgtysvnatnsvgratstaellvq

Timeline for d2f8vd2:

• d2f8vd2 first appeared in SCOPe 2.04
  
• d2f8vd2 appears in SCOPe 2.06
  
• d2f8vd2 appears in the current release, SCOPe 2.08