Lineage for d2eoba_ (2eob A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919247Species Norway rat (Rattus norvegicus) [TaxId:10116] [255150] (2 PDB entries)
  8. 1919249Domain d2eoba_: 2eob A: [241784]
    automated match to d1h9oa_

Details for d2eoba_

PDB Entry: 2eob (more details)

PDB Description: Solution structure of the second SH2 domain from rat PLC gamma-2
PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2

SCOPe Domain Sequences for d2eoba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eoba_ d.93.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gssgssgdpvpnpnpheskpwyydrlsrgeaedmlmriprdgaflirkregtdsyaitfr
argkvkhcrinrdgrhfvlgtsayfeslvelvsyyekhalyrkmrlrypvtpellerysg
pssg

SCOPe Domain Coordinates for d2eoba_:

Click to download the PDB-style file with coordinates for d2eoba_.
(The format of our PDB-style files is described here.)

Timeline for d2eoba_: