SCOPe 2.08: Domain d2eo1a1: 2eo1 A:8-102

Lineage for d2eo1a1 (2eo1 A:8-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2eo1a1: 2eo1 A:8-102 [241783]
   Other proteins in same PDB: d2eo1a2
   automated match to d2yxma_

Details for d2eo1a1

PDB Entry: 2eo1

PDB Description: solution structure of the ig domain of human obscn protein

PDB Compounds: (A:) CDNA FLJ14124 fis, clone MAMMA1002498

SCOPe Domain Sequences for d2eo1a1:

Sequence; same for both SEQRES and ATOM records:

>d2eo1a1 b.1.1.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvfakeqpahrevqaeagasatlscevaqaqtevtwykdgkklsssskvrveavgctrr
lvvqqagqaeageysceaggqqlsfrlqvagqcfg

Timeline for d2eo1a1:

• d2eo1a1 first appeared in SCOPe 2.04, called d2eo1a_
  
• d2eo1a1 appears in SCOPe 2.07