Lineage for d2ei2a2 (2ei2 A:138-302)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2187139Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2187140Protein automated matches [190239] (20 species)
    not a true protein
  7. 2187245Species Pseudomonas sp. [TaxId:69011] [230718] (5 PDB entries)
  8. 2187253Domain d2ei2a2: 2ei2 A:138-302 [241764]
    automated match to d2ei0a2
    complexed with fe2, gol, mg

Details for d2ei2a2

PDB Entry: 2ei2 (more details), 1.69 Å

PDB Description: Crystal Structure Analysis of the 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. stain C18
PDB Compounds: (A:) 1,2-dihydroxynaphthalene dioxygenase

SCOPe Domain Sequences for d2ei2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ei2a2 d.32.1.0 (A:138-302) automated matches {Pseudomonas sp. [TaxId: 69011]}
plhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyriplpngmtaelsfmhcna
rdhsiafgampaakrlnhlmleythmedlgythqqfvkneidialqlgihandkaltfyg
atpsgwliepgwrgataideaeyyvgdifghgveatgygldvkls

SCOPe Domain Coordinates for d2ei2a2:

Click to download the PDB-style file with coordinates for d2ei2a2.
(The format of our PDB-style files is described here.)

Timeline for d2ei2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ei2a1